| Brand: | Abnova |
| Reference: | H00009265-M01A |
| Product name: | CYTH3 monoclonal antibody (M01A), clone S1 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant CYTH3. |
| Clone: | S1 |
| Isotype: | IgG2b Kappa |
| Gene id: | 9265 |
| Gene name: | CYTH3 |
| Gene alias: | ARNO3|GRP1|PSCD3 |
| Gene description: | cytohesin 3 |
| Genbank accession: | BC008191.1 |
| Immunogen: | CYTH3 (AAH08191.1, 1 a.a. ~ 179 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIANKK |
| Protein accession: | AAH08191.1 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (45.43 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PSCD3 monoclonal antibody (M01A), clone 6D3-1A9 Western Blot analysis of PSCD3 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |