| Brand: | Abnova |
| Reference: | H00009265-M01 |
| Product name: | PSCD3 monoclonal antibody (M01), clone 6D3-1A9 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant PSCD3. |
| Clone: | 6D3-1A9 |
| Isotype: | IgG2b kappa |
| Gene id: | 9265 |
| Gene name: | CYTH3 |
| Gene alias: | ARNO3|GRP1|PSCD3 |
| Gene description: | cytohesin 3 |
| Genbank accession: | BC008191 |
| Immunogen: | PSCD3 (AAH08191, 1 a.a. ~ 180 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIANKK* |
| Protein accession: | AAH08191 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (45.8 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to PSCD3 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |