Cart 55 Product Products 21 634,17 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Transferri...259,07 € -
-
-
No products
To be determined Shipping
21 634,17 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 55 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 21 634,17 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 21 634,17 €
Data sheet of STK17A monoclonal antibody (M02), clone 3G8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about STK17A monoclonal antibody (M02), clone 3G8
| Brand: | Abnova |
| Reference: | H00009263-M02 |
| Product name: | STK17A monoclonal antibody (M02), clone 3G8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant STK17A. |
| Clone: | 3G8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 9263 |
| Gene name: | STK17A |
| Gene alias: | DRAK1 |
| Gene description: | serine/threonine kinase 17a |
| Genbank accession: | BC047696 |
| Immunogen: | STK17A (AAH47696, 301 a.a. ~ 413 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LLVKKPEDRATAEECLKHPWLTQSSIQEPSFRMEKALEEANALQEGHSVPEINSDTDKSETEESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKFEEPLLQEIPGEFI |
| Protein accession: | AAH47696 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.54 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | STK17A monoclonal antibody (M02), clone 3G8 Western Blot analysis of STK17A expression in NIH/3T3 ( Cat # L018V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |