Brand: | Abnova |
Reference: | H00009262-M01 |
Product name: | STK17B monoclonal antibody (M01), clone 2C3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant STK17B. |
Clone: | 2C3 |
Isotype: | IgG2b Kappa |
Gene id: | 9262 |
Gene name: | STK17B |
Gene alias: | DRAK2 |
Gene description: | serine/threonine kinase 17b |
Genbank accession: | BC016040 |
Immunogen: | STK17B (AAH16040, 272 a.a. ~ 372 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SLLVKNPEKRPTAEICLSHSWLQQWDFENLFHPEETSSSSQTQDHSVRSSEDKTSKSSCNGTCGDREDKENIPEDSSMVSKRFRFDDSLPNPHELVSDLLC |
Protein accession: | AAH16040 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to STK17B on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |