View larger

MAPKAPK2 monoclonal antibody (M10), clone 3A7

Reference:

Condition: New product

Data sheet of MAPKAPK2 monoclonal antibody (M10), clone 3A7

Brand:	Abnova
Reference:	H00009261-M10
Product name:	MAPKAPK2 monoclonal antibody (M10), clone 3A7
Product description:	Mouse monoclonal antibody raised against a full length recombinant MAPKAPK2.
Clone:	3A7
Isotype:	IgG2b Kappa
Gene id:	9261
Gene name:	MAPKAPK2
Gene alias:	MK2
Gene description:	mitogen-activated protein kinase-activated protein kinase 2
Genbank accession:	NM_032960
Immunogen:	MAPKAPK2 (NP_116584, 266 a.a. ~ 352 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	NHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDV
Protein accession:	NP_116584
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (35.57 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human,Rat
Application image:
Application image note:	MAPKAPK2 monoclonal antibody (M10), clone 3A7 Western Blot analysis of MAPKAPK2 expression in PC-12 ( Cat # L012V1 ).
Applications:	WB-Ce,IF,ELISA,WB-Re
Shipping condition:	Dry Ice