No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse,Rat |
Host species | Mouse |
Applications | WB-Ce,IHC-P,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00009261-M08 |
Product name: | MAPKAPK2 monoclonal antibody (M08), clone 3B8 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant MAPKAPK2. |
Clone: | 3B8 |
Isotype: | IgG2a Kappa |
Gene id: | 9261 |
Gene name: | MAPKAPK2 |
Gene alias: | MK2 |
Gene description: | mitogen-activated protein kinase-activated protein kinase 2 |
Genbank accession: | NM_032960 |
Immunogen: | MAPKAPK2 (NP_116584, 266 a.a. ~ 352 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDV |
Protein accession: | NP_116584 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.57 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: | ![]() |
Application image note: | MAPKAPK2 monoclonal antibody (M08), clone 3B8 Western Blot analysis of MAPKAPK2 expression in Jurkat ( Cat # L017V1 ). |
Applications: | WB-Ce,IHC-P,ELISA,WB-Re |
Shipping condition: | Dry Ice |