Cart 82 Product Products 86 688,09 € (empty)
No products
265,00 € DAP Shipping
86 953,09 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 82 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 86 688,09 €
Total shipping (tax excl.) 265,00 €
Total (tax excl.) 86 953,09 €
Data sheet of MAPKAPK2 monoclonal antibody (M06), clone 1F9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,ELISA,WB-Re,IP |
More info about MAPKAPK2 monoclonal antibody (M06), clone 1F9
| Brand: | Abnova |
| Reference: | H00009261-M06 |
| Product name: | MAPKAPK2 monoclonal antibody (M06), clone 1F9 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant MAPKAPK2. |
| Clone: | 1F9 |
| Isotype: | IgG2b Kappa |
| Gene id: | 9261 |
| Gene name: | MAPKAPK2 |
| Gene alias: | MK2 |
| Gene description: | mitogen-activated protein kinase-activated protein kinase 2 |
| Genbank accession: | NM_032960 |
| Immunogen: | MAPKAPK2 (NP_116584, 266 a.a. ~ 352 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | NHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDV |
| Protein accession: | NP_116584 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.57 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoprecipitation of MAPKAPK2 transfected lysate using anti-MAPKAPK2 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with MAPKAPK2 MaxPab rabbit polyclonal antibody. |
| Applications: | IF,ELISA,WB-Re,IP |
| Shipping condition: | Dry Ice |