MAPKAPK2 monoclonal antibody (M02), clone 2A10 View larger

MAPKAPK2 monoclonal antibody (M02), clone 2A10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MAPKAPK2 monoclonal antibody (M02), clone 2A10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about MAPKAPK2 monoclonal antibody (M02), clone 2A10

Brand: Abnova
Reference: H00009261-M02
Product name: MAPKAPK2 monoclonal antibody (M02), clone 2A10
Product description: Mouse monoclonal antibody raised against a full length recombinant MAPKAPK2.
Clone: 2A10
Isotype: IgG2a Kappa
Gene id: 9261
Gene name: MAPKAPK2
Gene alias: MK2
Gene description: mitogen-activated protein kinase-activated protein kinase 2
Genbank accession: NM_032960
Immunogen: MAPKAPK2 (NP_116584, 266 a.a. ~ 352 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDV
Protein accession: NP_116584
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009261-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.57 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MAPKAPK2 monoclonal antibody (M02), clone 2A10 now

Add to cart