Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CACNA2D2 monoclonal antibody (M12), clone 4E3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
More info about CACNA2D2 monoclonal antibody (M12), clone 4E3
| Brand: | Abnova |
| Reference: | H00009254-M12 |
| Product name: | CACNA2D2 monoclonal antibody (M12), clone 4E3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CACNA2D2. |
| Clone: | 4E3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 9254 |
| Gene name: | CACNA2D2 |
| Gene alias: | CACNA2D|KIAA0558|LUAC11.1 |
| Gene description: | calcium channel, voltage-dependent, alpha 2/delta subunit 2 |
| Genbank accession: | NM_006030 |
| Immunogen: | CACNA2D2 (NP_006021, 65 a.a. ~ 162 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PQQHTMQHWARRLEQEVDGVMRIFGGVQQLREIYKDNRNLFEVQENEPQKLVEKVAGDIESLLDRKVQALKRLADAAENFQKAHRWQDNIKEEDIVYY |
| Protein accession: | NP_006021 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CACNA2D2 monoclonal antibody (M12), clone 4E3. Western Blot analysis of CACNA2D2 expression in HeLa(Cat # L013V1 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | A Novel Null Homozygous Mutation ConfirmsCACNA2D2 as a Gene Mutated in Epileptic Encephalopathy.Pippucci T, Parmeggiani A, Palombo F, Maresca A, Angius A, Crisponi L, Cucca F, Liguori R, Valentino ML, Seri M, Carelli V PLoS One. 2013 Dec 16;8(12):e82154. doi: 10.1371/journal.pone.0082154. |