| Brand:  | Abnova | 
| Reference:  | H00009252-M11 | 
| Product name:  | RPS6KA5 monoclonal antibody (M11), clone 1G7 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant RPS6KA5. | 
| Clone:  | 1G7 | 
| Isotype:  | IgG2a Kappa | 
| Gene id:  | 9252 | 
| Gene name:  | RPS6KA5 | 
| Gene alias:  | MGC1911|MSK1|MSPK1|RLPK | 
| Gene description:  | ribosomal protein S6 kinase, 90kDa, polypeptide 5 | 
| Genbank accession:  | BC017187 | 
| Immunogen:  | RPS6KA5 (AAH17187.1, 372 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | FQGYSFVAPSILFKRNAAVIDPLQFHMGVERPGVTNVARSAMMKDSPFYQHYDLDLKDKPLGEGSFSICRKCVHKKSNQAFAVKIISKRMEANTQKEIT | 
| Protein accession:  | AAH17187.1 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | Detection limit for recombinant GST tagged RPS6KA5 is 0.3 ng/ml as a capture antibody. | 
| Applications:  | IF,S-ELISA,ELISA | 
| Shipping condition:  | Dry Ice |