| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00009246-M01 |
| Product name: | UBE2L6 monoclonal antibody (M01), clone 2F12-1F4 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant UBE2L6. |
| Clone: | 2F12-1F4 |
| Isotype: | IgG1 kappa |
| Gene id: | 9246 |
| Gene name: | UBE2L6 |
| Gene alias: | MGC40331|RIG-B|UBCH8 |
| Gene description: | ubiquitin-conjugating enzyme E2L 6 |
| Genbank accession: | BC032491 |
| Immunogen: | UBE2L6 (AAH32491, 1 a.a. ~ 153 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS |
| Protein accession: | AAH32491 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (42.57 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of UBE2L6 expression in transfected 293T cell line by UBE2L6 monoclonal antibody (M01), clone 2F12-1F4. Lane 1: UBE2L6 transfected lysate(17.595 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Interactions between PBEF and oxidative stress proteins - A potential new mechanism underlying PBEF in the pathogenesis of acute lung injury.Zhang LQ, Adyshev DM, Singleton P, Li H, Cepeda J, Huang SY, Zou X, Verin AD, Tu J, Garcia JG, Ye SQ. FEBS Lett. 2008 Jun 11;582(13):1802-8. Epub 2008 May 16. |