Cart 1 Product Products 369,00 € (empty)
No products
To be determined Shipping
369,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 369,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 369,00 €
Data sheet of NOG monoclonal antibody (M11), clone 2C10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about NOG monoclonal antibody (M11), clone 2C10
| Brand: | Abnova |
| Reference: | H00009241-M11 |
| Product name: | NOG monoclonal antibody (M11), clone 2C10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NOG. |
| Clone: | 2C10 |
| Isotype: | IgG2b Kappa |
| Gene id: | 9241 |
| Gene name: | NOG |
| Gene alias: | SYM1|SYNS1 |
| Gene description: | noggin |
| Genbank accession: | NM_005450 |
| Immunogen: | NOG (NP_005441, 27 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKL |
| Protein accession: | NP_005441 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (39.09 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of NOG expression in transfected 293T cell line by NOG monoclonal antibody (M11), clone 2C10. Lane 1: NOG transfected lysate(25.8 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |