| Brand:  | Abnova | 
| Reference:  | H00009241-M01 | 
| Product name:  | NOG monoclonal antibody (M01), clone 4C9 | 
| Product description:  | Mouse monoclonal antibody raised against a full length recombinant NOG. | 
| Clone:  | 4C9 | 
| Isotype:  | IgG2b Kappa | 
| Gene id:  | 9241 | 
| Gene name:  | NOG | 
| Gene alias:  | SYM1|SYNS1 | 
| Gene description:  | noggin | 
| Genbank accession:  | BC034027 | 
| Immunogen:  | NOG (AAH34027, 28 a.a. ~ 232 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC | 
| Protein accession:  | AAH34027 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (48.29 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Applications:  | ELISA,WB-Re | 
| Shipping condition:  | Dry Ice |