IL32 purified MaxPab rabbit polyclonal antibody (D01P) View larger

IL32 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IL32 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr

More info about IL32 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00009235-D01P
Product name: IL32 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human IL32 protein.
Gene id: 9235
Gene name: IL32
Gene alias: IL-32alpha|IL-32beta|IL-32delta|IL-32gamma|NK4|TAIF|TAIFa|TAIFb|TAIFc|TAIFd
Gene description: interleukin 32
Genbank accession: NM_001012631
Immunogen: IL32 (NP_001012649.1, 1 a.a. ~ 188 a.a) full-length human protein.
Immunogen sequence/protein sequence: MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKVVALVHAVQALWKQFQSFCCSLSELFMSSFQSYGAPRGDKEELTPQKCSEPQSSK
Protein accession: NP_001012649.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00009235-D01P-13-15-1.jpg
Application image note: Western Blot analysis of IL32 expression in transfected 293T cell line (H00009235-T02) by IL32 MaxPab polyclonal antibody.

Lane 1: IL32 transfected lysate(21.70 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy IL32 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart