Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 395,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 395,00 €
Data sheet of MAGI1 monoclonal antibody (M03), clone 7B4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
More info about MAGI1 monoclonal antibody (M03), clone 7B4
| Brand: | Abnova |
| Reference: | H00009223-M03 |
| Product name: | MAGI1 monoclonal antibody (M03), clone 7B4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MAGI1. |
| Clone: | 7B4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 9223 |
| Gene name: | MAGI1 |
| Gene alias: | AIP3|BAIAP1|BAP1|MAGI-1|TNRC19|WWP3 |
| Gene description: | membrane associated guanylate kinase, WW and PDZ domain containing 1 |
| Genbank accession: | NM_004742 |
| Immunogen: | MAGI1 (NP_004733, 761 a.a. ~ 859 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SHSTQVLPEFPPAEAQAPDQTDSSGQKKPDPFKIWAQSRSMYENRPMSPSPASGLSKGEREREINSTNFGECPIPDYQEQDIFLWRKETGFGFRILGGN |
| Protein accession: | NP_004733 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to MAGI1 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | MAGI-1, A Candidate Stereociliary Scaffolding Protein, Associates with the Tip-Link Component Cadherin 23.Xu Z, Peng AW, Oshima K, Heller S. J Neurosci. 2008 Oct 29;28(44):11269-76. |