Brand: | Abnova |
Reference: | H00009223-M02 |
Product name: | MAGI1 monoclonal antibody (M02), clone 3B4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MAGI1. |
Clone: | 3B4 |
Isotype: | IgG1 Kappa |
Gene id: | 9223 |
Gene name: | MAGI1 |
Gene alias: | AIP3|BAIAP1|BAP1|MAGI-1|TNRC19|WWP3 |
Gene description: | membrane associated guanylate kinase, WW and PDZ domain containing 1 |
Genbank accession: | NM_004742 |
Immunogen: | MAGI1 (NP_004733, 761 a.a. ~ 859 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SHSTQVLPEFPPAEAQAPDQTDSSGQKKPDPFKIWAQSRSMYENRPMSPSPASGLSKGEREREINSTNFGECPIPDYQEQDIFLWRKETGFGFRILGGN |
Protein accession: | NP_004733 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to MAGI1 on HeLa cell . [antibody concentration 10 ug/ml] |
Applications: | IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |