Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NOLC1 monoclonal antibody (M02), clone 6B4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
More info about NOLC1 monoclonal antibody (M02), clone 6B4
| Brand: | Abnova |
| Reference: | H00009221-M02 |
| Product name: | NOLC1 monoclonal antibody (M02), clone 6B4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NOLC1. |
| Clone: | 6B4 |
| Isotype: | IgG3 Kappa |
| Gene id: | 9221 |
| Gene name: | NOLC1 |
| Gene alias: | KIAA0035|NOPP130|NOPP140|NS5ATP13|P130 |
| Gene description: | nucleolar and coiled-body phosphoprotein 1 |
| Genbank accession: | NM_004741 |
| Immunogen: | NOLC1 (NP_004732, 590 a.a. ~ 699 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EAAKEAETPQAKKIKLQTPNTFPKRKKGEKRASSPFRRVREEEIEVDSRVADNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQVNSIKFDSE |
| Protein accession: | NP_004732 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | NOLC1 monoclonal antibody (M02), clone 6B4 Western Blot analysis of NOLC1 expression in HepG2 ( Cat # L019V1 ). |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |