Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of VAPA MaxPab rabbit polyclonal antibody (D01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IP |
More info about VAPA MaxPab rabbit polyclonal antibody (D01)
| Brand: | Abnova |
| Reference: | H00009218-D01 |
| Product name: | VAPA MaxPab rabbit polyclonal antibody (D01) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human VAPA protein. |
| Gene id: | 9218 |
| Gene name: | VAPA |
| Gene alias: | MGC3745|VAP-33|VAP-A|VAP33|hVAP-33 |
| Gene description: | VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa |
| Genbank accession: | ENST00000349843 |
| Immunogen: | VAPA (ENSP00000217602, 1 a.a. ~ 242 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSPLPSLLVVIAAIFIGFFLGKFIL |
| Protein accession: | ENSP00000217602 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoprecipitation of VAPA transfected lysate using anti-VAPA MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with VAPA purified MaxPab mouse polyclonal antibody (B01P) (H00009218-B01P). |
| Applications: | IP |
| Shipping condition: | Dry Ice |
| Publications: | Molecular partners of hNOT/ALG3, the human counterpart of the Drosophila NOT and yeast ALG3 gene, suggest its involvement in distinct cellular processes relevant to congenital disorders of glycosylation, cancer, neurodegeneration and a variety of further pathologies.Hacker B, Schultheis C, Doring M, Kurzik-Dumke U. Hum Mol Genet. 2018 Mar 14. [Epub ahead of print] |