No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00009218-B01P |
Product name: | VAPA purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human VAPA protein. |
Gene id: | 9218 |
Gene name: | VAPA |
Gene alias: | MGC3745|VAP-33|VAP-A|VAP33|hVAP-33 |
Gene description: | VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa |
Genbank accession: | ENST00000349843 |
Immunogen: | VAPA (ENSP00000217602, 1 a.a. ~ 242 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSPLPSLLVVIAAIFIGFFLGKFIL |
Protein accession: | ENSP00000217602 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of VAPA expression in transfected 293T cell line (H00009218-T01) by VAPA MaxPab polyclonal antibody. Lane 1: VAPA transfected lysate(26.62 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |