Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of FAIM3 monoclonal antibody (M01), clone 1E4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about FAIM3 monoclonal antibody (M01), clone 1E4
| Brand: | Abnova |
| Reference: | H00009214-M01 |
| Product name: | FAIM3 monoclonal antibody (M01), clone 1E4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant FAIM3. |
| Clone: | 1E4 |
| Isotype: | IgG2b Kappa |
| Gene id: | 9214 |
| Gene name: | FAIM3 |
| Gene alias: | TOSO |
| Gene description: | Fas apoptotic inhibitory molecule 3 |
| Genbank accession: | BC006401 |
| Immunogen: | FAIM3 (AAH06401, 124 a.a. ~ 223 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SEYEPSWEEQPMPETPKWFHLPYLFQMPAYASSSKFVTRVTTPAQRGKVPPVHHSSPTTQITHRPRVSRASSVAGDKPRTFLPSTTASKISALEGLLKPQ |
| Protein accession: | AAH06401 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | FAIM3 monoclonal antibody (M01), clone 1E4 Western Blot analysis of FAIM3 expression in K-562 ( Cat # L009V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Toso, a Functional IgM Receptor, Is Regulated by IL-2 in T and NK Cells.Murakami Y, Narayanan S, Su S, Childs R, Krzewski K, Borrego F, Weck J, Coligan JE. J Immunol. 2012 Jun 6. |