AURKB monoclonal antibody (M02), clone 5H7 View larger

AURKB monoclonal antibody (M02), clone 5H7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AURKB monoclonal antibody (M02), clone 5H7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about AURKB monoclonal antibody (M02), clone 5H7

Brand: Abnova
Reference: H00009212-M02
Product name: AURKB monoclonal antibody (M02), clone 5H7
Product description: Mouse monoclonal antibody raised against a partial recombinant AURKB.
Clone: 5H7
Isotype: IgG1 Kappa
Gene id: 9212
Gene name: AURKB
Gene alias: AIK2|AIM-1|AIM1|ARK2|AurB|IPL1|STK12|STK5
Gene description: aurora kinase B
Genbank accession: BC009751
Immunogen: AURKB (AAH09751, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTRHFTIDDFEIGRPLGKGKFGN
Protein accession: AAH09751
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009212-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.53 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009212-M02-1-12-1.jpg
Application image note: AURKB monoclonal antibody (M02), clone 5H7. Western Blot analysis of AURKB expression in HepG2.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy AURKB monoclonal antibody (M02), clone 5H7 now

Add to cart