Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of AURKB monoclonal antibody (M01A), clone 6A6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about AURKB monoclonal antibody (M01A), clone 6A6
| Brand: | Abnova |
| Reference: | H00009212-M01A |
| Product name: | AURKB monoclonal antibody (M01A), clone 6A6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant AURKB. |
| Clone: | 6A6 |
| Isotype: | IgG1 Kappa |
| Gene id: | 9212 |
| Gene name: | AURKB |
| Gene alias: | AIK2|AIM-1|AIM1|ARK2|AurB|IPL1|STK12|STK5 |
| Gene description: | aurora kinase B |
| Genbank accession: | BC009751 |
| Immunogen: | AURKB (AAH09751, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTRHFTIDDFEIGRPLGKGKFGN |
| Protein accession: | AAH09751 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | AURKB monoclonal antibody (M01A), clone 6A6 Western Blot analysis of AURKB expression in HepG2 ( Cat # L019V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |