Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,WB-Tr |
Brand: | Abnova |
Reference: | H00009208-B02P |
Product name: | LRRFIP1 purified MaxPab mouse polyclonal antibody (B02P) |
Product description: | Mouse polyclonal antibody raised against a full-length human LRRFIP1 protein. |
Gene id: | 9208 |
Gene name: | LRRFIP1 |
Gene alias: | FLAP-1|FLIIAP1|GCF-2|GCF2|HUFI-1|MGC10947|MGC119738|MGC119739|TRIP |
Gene description: | leucine rich repeat (in FLII) interacting protein 1 |
Genbank accession: | BC010662.1 |
Immunogen: | LRRFIP1 (AAH10662.1, 1 a.a. ~ 105 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MHVMDLQRDANRQISDLKFKLAKSEQEITALEQNVIRLESQVSRYKSAAENAEKIEDELKAEKRKLQRELRSALDKTEELEVSNGHLVKRLEKMKANRSALLSQQ |
Protein accession: | AAH10662.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of LRRFIP1 expression in transfected 293T cell line (H00009208-T03) by LRRFIP1 MaxPab polyclonal antibody. Lane 1: LRRFIP1 transfected lysate(12.20 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,WB-Tr |
Shipping condition: | Dry Ice |