Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of DCAMKL1 monoclonal antibody (M01), clone 7D10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ti,S-ELISA,ELISA,WB-Re |
More info about DCAMKL1 monoclonal antibody (M01), clone 7D10
| Brand: | Abnova |
| Reference: | H00009201-M01 |
| Product name: | DCAMKL1 monoclonal antibody (M01), clone 7D10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DCAMKL1. |
| Clone: | 7D10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 9201 |
| Gene name: | DCLK1 |
| Gene alias: | DCAMKL1|DCDC3A|DCLK|KIAA0369 |
| Gene description: | doublecortin-like kinase 1 |
| Genbank accession: | NM_004734 |
| Immunogen: | DCAMKL1 (NP_004725, 640 a.a. ~ 729 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QVLEHPWVNDDGLPENEHQLSVAGKIKKHFNTGPKPNSTAAGVSVIALDHGFTIKRSGSLDYYQQPGMYWIRPPLLIRRGRFSDEDATRM |
| Protein accession: | NP_004725 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | DCAMKL1 monoclonal antibody (M01), clone 7D10. Western Blot analysis of DCLK1 expression in rat brain. |
| Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |