Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SLC33A1 monoclonal antibody (M07), clone 3A4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
More info about SLC33A1 monoclonal antibody (M07), clone 3A4
| Brand: | Abnova |
| Reference: | H00009197-M07 |
| Product name: | SLC33A1 monoclonal antibody (M07), clone 3A4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC33A1. |
| Clone: | 3A4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 9197 |
| Gene name: | SLC33A1 |
| Gene alias: | ACATN|AT-1|AT1|SPG42 |
| Gene description: | solute carrier family 33 (acetyl-CoA transporter), member 1 |
| Genbank accession: | NM_004733 |
| Immunogen: | SLC33A1 (NP_004724, 1 a.a. ~ 69 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSPTISHKDSSRQRRPGNFSHSLDMKSGPLPPGGWDDSHLDSAGREGDREALLGDTGTGDFLKAPQSFR |
| Protein accession: | NP_004724 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.33 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | SLC33A1 monoclonal antibody (M07), clone 3A4 Western Blot analysis of SLC33A1 expression in PC-12 ( Cat # L012V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |
| Publications: | SLC33A1/AT-1 regulates the induction of autophagy down-stream of IRE1/XBP1.Pehar M, Jonas MC, Hare TM, Puglielli L. J Biol Chem. 2012 Jul 11. |