Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of AP4M1 monoclonal antibody (M01), clone 2C4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Monoclonal |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA |
More info about AP4M1 monoclonal antibody (M01), clone 2C4
| Product description: | Mouse monoclonal antibody raised against a partial recombinant AP4M1. |
| Clone: | 2C4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 9179 |
| Gene name: | AP4M1 |
| Gene alias: | MU-4|MU-ARP2 |
| Gene description: | adaptor-related protein complex 4, mu 1 subunit |
| Genbank accession: | NM_004722 |
| Immunogen: | AP4M1 (NP_004713, 354 a.a. ~ 453 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AELAEGALRWDLPRVQGGSQLSGLFQMDVPGPPGPPSHGLSTSASPLGLGPASLSFELPRHTCSGLQVRFLRLAFRPCGNANPHKWVRHLSHSDAYVIRI |
| Protein accession: | NP_004713 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Size: | 100 ug |
| Shipping condition: | Dry Ice |