AP4M1 purified MaxPab rabbit polyclonal antibody (D01P) View larger

AP4M1 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AP4M1 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr

More info about AP4M1 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00009179-D01P
Product name: AP4M1 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human AP4M1 protein.
Gene id: 9179
Gene name: AP4M1
Gene alias: MU-4|MU-ARP2
Gene description: adaptor-related protein complex 4, mu 1 subunit
Genbank accession: NM_004722.2
Immunogen: AP4M1 (NP_004713.2, 1 a.a. ~ 453 a.a) full-length human protein.
Immunogen sequence/protein sequence: MISQFFILSSKGDPLIYKDFRGDSGGRDVAELFYRKLTGLPGDESPVVMHHHGRHFIHIRHSGLYLVVTTSENVSPFSLLELLSRLATLLGDYCGSLGEGTISRNVALVYELLDEVLDYGYVQTTSTEMLRNFIQTEAVVSKPFSLFDLSSVGLFGAETQQSKVAPSSAASRPVLSSRSDQSQKNEVFLDVVERLSVLIASNGSLLKVDVQGEIRLKSFLPSGSEMRIGLTEEFCVGKSELRGYGPGIRVDEVSFHSSVNLDEFESHRILRLQPPQGELTVMRYQLSDDLPSPLPFRLFPSVQWDRGSGRLQVYLKLRCDLLSKSQALNVRLHLPLPRGVVSLSQELSSPEQKAELAEGALRWDLPRVQGGSQLSGLFQMDVPGPPGPPSHGLSTSASPLGLGPASLSFELPRHTCSGLQVRFLRLAFRPCGNANPHKWVRHLSHSDAYVIRI
Protein accession: NP_004713.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00009179-D01P-2-A2-1.jpg
Application image note: AP4M1 MaxPab rabbit polyclonal antibody. Western Blot analysis of AP4M1 expression in human colon.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy AP4M1 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart