AP4M1 MaxPab mouse polyclonal antibody (B01) View larger

AP4M1 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AP4M1 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about AP4M1 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00009179-B01
Product name: AP4M1 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human AP4M1 protein.
Gene id: 9179
Gene name: AP4M1
Gene alias: MU-4|MU-ARP2
Gene description: adaptor-related protein complex 4, mu 1 subunit
Genbank accession: NM_004722.2
Immunogen: AP4M1 (NP_004713.2, 1 a.a. ~ 453 a.a) full-length human protein.
Immunogen sequence/protein sequence: MISQFFILSSKGDPLIYKDFRGDSGGRDVAELFYRKLTGLPGDESPVVMHHHGRHFIHIRHSGLYLVVTTSENVSPFSLLELLSRLATLLGDYCGSLGEGTISRNVALVYELLDEVLDYGYVQTTSTEMLRNFIQTEAVVSKPFSLFDLSSVGLFGAETQQSKVAPSSAASRPVLSSRSDQSQKNEVFLDVVERLSVLIASNGSLLKVDVQGEIRLKSFLPSGSEMRIGLTEEFCVGKSELRGYGPGIRVDEVSFHSSVNLDEFESHRILRLQPPQGELTVMRYQLSDDLPSPLPFRLFPSVQWDRGSGRLQVYLKLRCDLLSKSQALNVRLHLPLPRGVVSLSQELSSPEQKAELAEGALRWDLPRVQGGSQLSGLFQMDVPGPPGPPSHGLSTSASPLGLGPASLSFELPRHTCSGLQVRFLRLAFRPCGNANPHKWVRHLSHSDAYVIRI
Protein accession: NP_004713.2
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009179-B01-13-15-1.jpg
Application image note: Western Blot analysis of AP4M1 expression in transfected 293T cell line (H00009179-T01) by AP4M1 MaxPab polyclonal antibody.

Lane 1: AP4M1 transfected lysate(49.83 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy AP4M1 MaxPab mouse polyclonal antibody (B01) now

Add to cart