HTR3B purified MaxPab mouse polyclonal antibody (B01P) View larger

HTR3B purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HTR3B purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about HTR3B purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00009177-B01P
Product name: HTR3B purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human HTR3B protein.
Gene id: 9177
Gene name: HTR3B
Gene alias: 5-HT3B
Gene description: 5-hydroxytryptamine (serotonin) receptor 3B
Genbank accession: NM_006028.3
Immunogen: HTR3B (NP_006019.1, 1 a.a. ~ 441 a.a) full-length human protein.
Immunogen sequence/protein sequence: MLSSVMAPLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKATTVYLDLFVHAILDVDAENQILKTSVWYQEVWNDEFLSWNSSMFDEIREISLPLSAIWAPDIIINEFVDIERYPDLPYVYVNSSGTIENYKPIQVVSACSLETYAFPFDVQNCSLTFKSILHTVEDVDLAFLRSPEDIQHDKKAFLNDSEWELLSVSSTYSILQSSAGGFAQIQFNVVMRRHPLVYVVSLLIPSIFLMLVDLGSFYLPPNCRARIVFKTSVLVGYTVFRVNMSNQVPRSVGSTPLIGHFFTICMAFLVLSLAKSIVLVKFLHDEQRGGQEQPFLCLRGDTDADRPRVEPRAQRAVVTESSLYGEHLAQPGTLKEVWSQLQSISNYLQTQDQTDQQEAEWLVLLSRFDRLLFQSYLFMLGIYTITLCSLWALWGGV
Protein accession: NP_006019.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009177-B01P-13-15-1.jpg
Application image note: Western Blot analysis of HTR3B expression in transfected 293T cell line (H00009177-T01) by HTR3B MaxPab polyclonal antibody.

Lane 1: HTR3B transfected lysate(50.30 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy HTR3B purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart