| Brand: | Abnova |
| Reference: | H00009175-M04 |
| Product name: | MAP3K13 monoclonal antibody (M04), clone 4H7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MAP3K13. |
| Clone: | 4H7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 9175 |
| Gene name: | MAP3K13 |
| Gene alias: | LZK|MGC133196 |
| Gene description: | mitogen-activated protein kinase kinase kinase 13 |
| Genbank accession: | NM_004721 |
| Immunogen: | MAP3K13 (NP_004712.1, 711 a.a. ~ 810 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SEPDKGQAGPWGCCQADAYDPCLQCRPEQYGSLDIPSAEPVGRSPDLSKSPAHNPLLENAQSSEKTEENEFSGCRSESSLGTSHLGTPPALPRKTRPLQK |
| Protein accession: | NP_004712.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to MAP3K13 on HeLa cell . [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |