COX7A2L purified MaxPab mouse polyclonal antibody (B02P) View larger

COX7A2L purified MaxPab mouse polyclonal antibody (B02P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of COX7A2L purified MaxPab mouse polyclonal antibody (B02P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Tr

More info about COX7A2L purified MaxPab mouse polyclonal antibody (B02P)

Brand: Abnova
Reference: H00009167-B02P
Product name: COX7A2L purified MaxPab mouse polyclonal antibody (B02P)
Product description: Mouse polyclonal antibody raised against a full-length human COX7A2L protein.
Gene id: 9167
Gene name: COX7A2L
Gene alias: COX7AR|COX7RP|EB1|SIG81
Gene description: cytochrome c oxidase subunit VIIa polypeptide 2 like
Genbank accession: NM_004718.2
Immunogen: COX7A2L (NP_004709.2, 1 a.a. ~ 114 a.a) full-length human protein.
Immunogen sequence/protein sequence: MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK
Protein accession: NP_004709.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009167-B02P-13-15-1.jpg
Application image note: Western Blot analysis of COX7A2L expression in transfected 293T cell line (H00009167-T02) by COX7A2L MaxPab polyclonal antibody.

Lane 1: COX7A2L transfected lysate(12.54 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy COX7A2L purified MaxPab mouse polyclonal antibody (B02P) now

Add to cart