Brand: | Abnova |
Reference: | H00009166-M04 |
Product name: | EBAG9 monoclonal antibody (M04), clone 4A10 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant EBAG9. |
Clone: | 4A10 |
Isotype: | IgG2a Kappa |
Gene id: | 9166 |
Gene name: | EBAG9 |
Gene alias: | EB9|PDAF|RCAS1 |
Gene description: | estrogen receptor binding site associated, antigen, 9 |
Genbank accession: | BC017729 |
Immunogen: | EBAG9 (AAH17729, 1 a.a. ~ 213 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAITQFRLFKFCTCLATVFSFLKRLICRSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGIPDGSTGFSSRLAATQDLPFIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGVKLS |
Protein accession: | AAH17729 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (49.17 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged EBAG9 is 0.1 ng/ml as a capture antibody. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |