| Brand: | Abnova |
| Reference: | H00009149-A01 |
| Product name: | DYRK1B polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant DYRK1B. |
| Gene id: | 9149 |
| Gene name: | DYRK1B |
| Gene alias: | MIRK |
| Gene description: | dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1B |
| Genbank accession: | BC025291 |
| Immunogen: | DYRK1B (AAH25291, 479 a.a. ~ 569 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | DNRTYRYSNRYCGGPGPPITDCEMNSPQVPPSQPLRPWAGGDVPHKTHQAPASASSLPGTGAQLPPQPRYLGRPPSPTSPPPPELMDVSLV |
| Protein accession: | AAH25291 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.01 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |