| Brand: | Abnova |
| Reference: | H00009146-M01 |
| Product name: | HGS monoclonal antibody (M01), clone 6D11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HGS. |
| Clone: | 6D11 |
| Isotype: | IgG1 Kappa |
| Gene id: | 9146 |
| Gene name: | HGS |
| Gene alias: | HRS|ZFYVE8 |
| Gene description: | hepatocyte growth factor-regulated tyrosine kinase substrate |
| Genbank accession: | BC003565 |
| Immunogen: | HGS (AAH03565, 513 a.a. ~ 612 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVEGSPMHGVYMSQP |
| Protein accession: | AAH03565 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to HGS on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |
| Publications: | The Class III Kinase Vps34 Promotes T Lymphocyte Survival through Regulating IL-7Rα Surface Expression.McLeod IX, Zhou X, Li QJ, Wang F, He YW. J Immunol. 2011 Nov 15;187(10):5051-61. Epub 2011 Oct 21. |