Product successfully added to your shopping cart
Quantity
Total
There are 3 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 1 159,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 1 159,00 €
Data sheet of HGS polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about HGS polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00009146-A01 |
| Product name: | HGS polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant HGS. |
| Gene id: | 9146 |
| Gene name: | HGS |
| Gene alias: | HRS|ZFYVE8 |
| Gene description: | hepatocyte growth factor-regulated tyrosine kinase substrate |
| Genbank accession: | BC003565 |
| Immunogen: | HGS (AAH03565, 513 a.a. ~ 612 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | KLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVEGSPMHGVYMSQP |
| Protein accession: | AAH03565 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | HGS polyclonal antibody (A01), Lot # 051115JC01 Western Blot analysis of HGS expression in Jurkat ( Cat # L017V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Endosomal clathrin drives actin accumulation at the immunological synapse.Calabia-Linares C, Robles-Valero J, de la Fuente H, Perez-Martinez M, Martin-Cofreces N, Alfonso-Perez M, Gutierrez-Vazquez C, Mittelbrunn M, Ibiza S, Urbano-Olmos FR, Aguado-Ballano C, Sanchez-Sorzano CO, Sanchez-Madrid F, Veiga E. J Cell Sci. 2011 Mar 1;124(Pt 5):820-30. |