Brand: | Abnova |
Reference: | H00009140-M01 |
Product name: | ATG12 monoclonal antibody (M01), clone 2H8 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant ATG12. |
Clone: | 2H8 |
Isotype: | IgG1 Kappa |
Gene id: | 9140 |
Gene name: | ATG12 |
Gene alias: | APG12|APG12L|FBR93|HAPG12 |
Gene description: | ATG12 autophagy related 12 homolog (S. cerevisiae) |
Genbank accession: | BC011033 |
Immunogen: | ATG12 (AAH11033, 1 a.a. ~ 74 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIYLCESVLCSFPRPRSWNSL |
Protein accession: | AAH11033 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.88 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ATG12 is approximately 1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |