Cart 28 Product Products 6 510,16 € (empty)
Product successfully added to your shopping cart
Quantity
Total
There are 28 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 6 510,16 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 6 510,16 €
Data sheet of ATG12 monoclonal antibody (M01), clone 2H8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about ATG12 monoclonal antibody (M01), clone 2H8
| Brand: | Abnova |
| Reference: | H00009140-M01 |
| Product name: | ATG12 monoclonal antibody (M01), clone 2H8 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant ATG12. |
| Clone: | 2H8 |
| Isotype: | IgG1 Kappa |
| Gene id: | 9140 |
| Gene name: | ATG12 |
| Gene alias: | APG12|APG12L|FBR93|HAPG12 |
| Gene description: | ATG12 autophagy related 12 homolog (S. cerevisiae) |
| Genbank accession: | BC011033 |
| Immunogen: | ATG12 (AAH11033, 1 a.a. ~ 74 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIYLCESVLCSFPRPRSWNSL |
| Protein accession: | AAH11033 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.88 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ATG12 is approximately 1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |