ATG12 purified MaxPab mouse polyclonal antibody (B01P) View larger

ATG12 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ATG12 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about ATG12 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00009140-B01P
Product name: ATG12 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human ATG12 protein.
Gene id: 9140
Gene name: ATG12
Gene alias: APG12|APG12L|FBR93|HAPG12
Gene description: ATG12 autophagy related 12 homolog (S. cerevisiae)
Genbank accession: NM_004707
Immunogen: ATG12 (NP_004698.2, 1 a.a. ~ 187 a.a) full-length human protein.
Immunogen sequence/protein sequence: MTSREHQVSLCNCVPLLRRLLCDAPWRKARPLHALSRYFRSRVSPSKMAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG
Protein accession: NP_004698.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009140-B01P-13-15-1.jpg
Application image note: Western Blot analysis of ATG12 expression in transfected 293T cell line (H00009140-T01) by ATG12 MaxPab polyclonal antibody.

Lane 1: ATG12 transfected lysate(20.57 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ATG12 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart