Cart 15 Product Products 5 028,90 € (empty)
No products
265,00 € DAP Shipping
5 293,90 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 15 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 5 028,90 €
Total shipping (tax excl.) 265,00 €
Total (tax excl.) 5 293,90 €
Data sheet of ATG12 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about ATG12 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00009140-B01P |
| Product name: | ATG12 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human ATG12 protein. |
| Gene id: | 9140 |
| Gene name: | ATG12 |
| Gene alias: | APG12|APG12L|FBR93|HAPG12 |
| Gene description: | ATG12 autophagy related 12 homolog (S. cerevisiae) |
| Genbank accession: | NM_004707 |
| Immunogen: | ATG12 (NP_004698.2, 1 a.a. ~ 187 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MTSREHQVSLCNCVPLLRRLLCDAPWRKARPLHALSRYFRSRVSPSKMAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG |
| Protein accession: | NP_004698.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of ATG12 expression in transfected 293T cell line (H00009140-T01) by ATG12 MaxPab polyclonal antibody. Lane 1: ATG12 transfected lysate(20.57 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |