No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00009139-M15 |
Product name: | CBFA2T2 monoclonal antibody (M15), clone 2C10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CBFA2T2. |
Clone: | 2C10 |
Isotype: | IgG2b Kappa |
Gene id: | 9139 |
Gene name: | CBFA2T2 |
Gene alias: | DKFZp313F2116|EHT|MTGR1|ZMYND3 |
Gene description: | core-binding factor, runt domain, alpha subunit 2; translocated to, 2 |
Genbank accession: | NM_001032999 |
Immunogen: | CBFA2T2 (NP_001028171.1, 201 a.a. ~ 304 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LLLNTSIASPADSSELLMEVHGNGKRPSPERREENSFDRDTIAPEPPAKRVCTISPAPRHSPALTVPLMNPGGQFHPTPPPLQHYTLEDIATSHLYREPNKMLE |
Protein accession: | NP_001028171.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.18 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of CBFA2T2 expression in transfected 293T cell line by CBFA2T2 monoclonal antibody (M15), clone 2C10. Lane 1: CBFA2T2 transfected lysate(63.9 KDa). Lane 2: Non-transfected lysate. |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |