| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00009139-M15 |
| Product name: | CBFA2T2 monoclonal antibody (M15), clone 2C10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CBFA2T2. |
| Clone: | 2C10 |
| Isotype: | IgG2b Kappa |
| Gene id: | 9139 |
| Gene name: | CBFA2T2 |
| Gene alias: | DKFZp313F2116|EHT|MTGR1|ZMYND3 |
| Gene description: | core-binding factor, runt domain, alpha subunit 2; translocated to, 2 |
| Genbank accession: | NM_001032999 |
| Immunogen: | CBFA2T2 (NP_001028171.1, 201 a.a. ~ 304 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LLLNTSIASPADSSELLMEVHGNGKRPSPERREENSFDRDTIAPEPPAKRVCTISPAPRHSPALTVPLMNPGGQFHPTPPPLQHYTLEDIATSHLYREPNKMLE |
| Protein accession: | NP_001028171.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.18 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of CBFA2T2 expression in transfected 293T cell line by CBFA2T2 monoclonal antibody (M15), clone 2C10. Lane 1: CBFA2T2 transfected lysate(63.9 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |