| Brand: | Abnova |
| Reference: | H00009138-M02 |
| Product name: | ARHGEF1 monoclonal antibody (M02), clone 2D2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ARHGEF1. |
| Clone: | 2D2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 9138 |
| Gene name: | ARHGEF1 |
| Gene alias: | GEF1|LBCL2|LSC|P115-RHOGEF|SUB1.5 |
| Gene description: | Rho guanine nucleotide exchange factor (GEF) 1 |
| Genbank accession: | BC034013 |
| Immunogen: | ARHGEF1 (AAH34013.2, 830 a.a. ~ 927 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | CRPGPEGQLAATALRKVLSLKQLLFPAEEDNGAGPPRDGDGVPGGGPLSPARTQEIQENLLSLEETMKQLEELEEEFCRLRPLLSQLGGNSVPQPGCT |
| Protein accession: | AAH34013.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.41 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ARHGEF1 is approximately 1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |