ARHGEF1 polyclonal antibody (A01) View larger

ARHGEF1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ARHGEF1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about ARHGEF1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00009138-A01
Product name: ARHGEF1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant ARHGEF1.
Gene id: 9138
Gene name: ARHGEF1
Gene alias: GEF1|LBCL2|LSC|P115-RHOGEF|SUB1.5
Gene description: Rho guanine nucleotide exchange factor (GEF) 1
Genbank accession: BC034013
Immunogen: ARHGEF1 (AAH34013, 830 a.a. ~ 927 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: CRPGPEGQLAATALRKVLSLKQLLFPAEEDNGAGPPRDGDGVPGGGPLSPARTQEIQENLLSLEETMKQLEELEEEFCRLRPLLSQLGGNSVPQPGCT
Protein accession: AAH34013
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009138-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.78 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009138-A01-1-9-1.jpg
Application image note: ARHGEF1 polyclonal antibody (A01), Lot # 060726QCS1 Western Blot analysis of ARHGEF1 expression in K-562 ( Cat # L009V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ARHGEF1 polyclonal antibody (A01) now

Add to cart