| Brand: | Abnova |
| Reference: | H00009135-M06 |
| Product name: | RABEP1 monoclonal antibody (M06), clone 3H6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RABEP1. |
| Clone: | 3H6 |
| Isotype: | IgG1 Kappa |
| Gene id: | 9135 |
| Gene name: | RABEP1 |
| Gene alias: | RAB5EP|RABPT5 |
| Gene description: | rabaptin, RAB GTPase binding effector protein 1 |
| Genbank accession: | NM_004703 |
| Immunogen: | RABEP1 (NP_004694.2, 765 a.a. ~ 862 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KSQQLESLQEIKISLEEQLKKETAAKATVEQLMFEEKNKAQRLQTELDVSEQVQRDFVKLSQTLQVQLERIRQADSLERIRAILNDTKLTDINQLPET |
| Protein accession: | NP_004694.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | RABEP1 monoclonal antibody (M06), clone 3H6. Western Blot analysis of RABEP1 expression in HepG2(Cat # L019V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |