| Brand: | Abnova |
| Reference: | H00009130-M02 |
| Product name: | FAM50A monoclonal antibody (M02), clone 5F10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant FAM50A. |
| Clone: | 5F10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 9130 |
| Gene name: | FAM50A |
| Gene alias: | 9F|DXS9928E|HXC-26|XAP5 |
| Gene description: | family with sequence similarity 50, member A |
| Genbank accession: | NM_004699 |
| Immunogen: | FAM50A (NP_004690, 1 a.a. ~ 88 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAQYKGAASEAGRAMHLMKKREKQREQMEQMKQRIAEENIMKSNIDKKFSAHYDAVEAELKSSTVGLVTLNDMKAKQEALVKEREKQL |
| Protein accession: | NP_004690 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.42 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | FAM50A monoclonal antibody (M02), clone 5F10 Western Blot analysis of FAM50A expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |