| Brand: | Abnova |
| Reference: | H00009114-M02 |
| Product name: | ATP6V0D1 monoclonal antibody (M02), clone 3B8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ATP6V0D1. |
| Clone: | 3B8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 9114 |
| Gene name: | ATP6V0D1 |
| Gene alias: | ATP6D|ATP6DV|P39|VATX|VMA6|VPATPD |
| Gene description: | ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 |
| Genbank accession: | NM_004691 |
| Immunogen: | ATP6V0D1 (NP_004682, 238 a.a. ~ 308 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLN |
| Protein accession: | NP_004682 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.55 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ATP6V0D1 monoclonal antibody (M02), clone 3B8. Western Blot analysis of ATP6V0D1 expression in HeLa(Cat # L013V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |