No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse,Rat |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00009097-M08 |
Product name: | USP14 monoclonal antibody (M08), clone 1F8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant USP14. |
Clone: | 1F8 |
Isotype: | IgG2a Kappa |
Gene id: | 9097 |
Gene name: | USP14 |
Gene alias: | TGT |
Gene description: | ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase) |
Genbank accession: | NM_005151 |
Immunogen: | USP14 (NP_005142, 395 a.a. ~ 494 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ |
Protein accession: | NP_005142 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: | ![]() |
Application image note: | USP14 monoclonal antibody (M08), clone 1F8. Western Blot analysis of USP14 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |