| Brand: | Abnova |
| Reference: | H00009096-M06 |
| Product name: | TBX18 monoclonal antibody (M06), clone 4D3 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant TBX18. |
| Clone: | 4D3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 9096 |
| Gene name: | TBX18 |
| Gene alias: | - |
| Gene description: | T-box 18 |
| Genbank accession: | XM_496819 |
| Immunogen: | TBX18 (XP_496819, 454 a.a. ~ 560 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | STLLQGTGNGVPATHPHLLSGSSCSSPAFHLGPNTSQLCSLAPADYSACARSGLTLNRYSTSLAETYNRLTNQAGETFAPPRTPSYVGVSSSTSVNMSMGGTDGDTF |
| Protein accession: | XP_496819 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.77 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | TBX18 monoclonal antibody (M06), clone 4D3 Western Blot analysis of TBX18 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,IF,ELISA,WB-Re |
| Shipping condition: | Dry Ice |