No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00009071-B01P |
Product name: | CLDN10 purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human CLDN10 protein. |
Gene id: | 9071 |
Gene name: | CLDN10 |
Gene alias: | CPETRL3|OSP-L |
Gene description: | claudin 10 |
Genbank accession: | BC010920 |
Immunogen: | CLDN10 (AAH10920, 1 a.a. ~ 228 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLWKACVTDSTGVSNCKDFPSMLALDGYIQACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDKAKAKIACLAGIVFILSGLCSMTGCSLYANKITTEFFDPLFVEQKYELGAALFIGWAGASLCIIGGVIFCFSISDNNKTPRYTYNGATSVMSSRTKYHGGEDFKTTNPSKQFDKNAYV |
Protein accession: | AAH10920 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of CLDN10 expression in transfected 293T cell line (H00009071-T01) by CLDN10 MaxPab polyclonal antibody. Lane 1: CLDN10 transfected lysate(25.19 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |