View larger

SYT7 monoclonal antibody (M01), clone 4H4

Reference:

Condition: New product

Data sheet of SYT7 monoclonal antibody (M01), clone 4H4

Brand:	Abnova
Reference:	H00009066-M01
Product name:	SYT7 monoclonal antibody (M01), clone 4H4
Product description:	Mouse monoclonal antibody raised against a partial recombinant SYT7.
Clone:	4H4
Isotype:	IgG2a Kappa
Gene id:	9066
Gene name:	SYT7
Gene alias:	IPCA-7\|MGC150517\|PCANAP7\|SYT-VII
Gene description:	synaptotagmin VII
Genbank accession:	NM_004200
Immunogen:	SYT7 (NP_004191.2, 41 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	CQRKLGKRYKNSLETVGTPDSGRGRSEKKAIKLPAGGKAVNTAPVPGQTPHDESDRRTEPRSSVSDLVNSLTSEMLMLSPGSEEDEAHEGCSRENLGRI
Protein accession:	NP_004191.2
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (36.63 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Detection limit for recombinant GST tagged SYT7 is 1 ng/ml as a capture antibody.
Applications:	S-ELISA,ELISA,WB-Re
Shipping condition:	Dry Ice