Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MAP3K6 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about MAP3K6 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00009064-A01 |
| Product name: | MAP3K6 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant MAP3K6. |
| Gene id: | 9064 |
| Gene name: | MAP3K6 |
| Gene alias: | ASK2|MAPKKK6|MGC125653|MGC20114 |
| Gene description: | mitogen-activated protein kinase kinase kinase 6 |
| Genbank accession: | BC015914 |
| Immunogen: | MAP3K6 (AAH15914, 225 a.a. ~ 325 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | HFWLHFLLQSCQPFKTACAQGDQCLVLVLEMNKVLLPAKLEVRGTDPVSTVTLSLLEPETQDIPSSWTFPVASICGVSASKRDERCCFLYALPPAQDVQLC |
| Protein accession: | AAH15914 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Mitogen-Activated Protein 3 Kinase 6 Mediates Angiogenic and Tumorigenic Effects via Vascular Endothelial Growth Factor Expression.Eto N, Miyagishi M, Inagi R, Fujita T, Nangaku M. Am J Pathol. 2009 Apr;174(4):1553-63. Epub 2009 Feb 26. |