Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SLC13A2 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about SLC13A2 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00009058-A01 |
| Product name: | SLC13A2 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant SLC13A2. |
| Gene id: | 9058 |
| Gene name: | SLC13A2 |
| Gene alias: | NADC1|NaDC-1 |
| Gene description: | solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 2 |
| Genbank accession: | NM_003984 |
| Immunogen: | SLC13A2 (NP_003975, 146 a.a. ~ 220 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | AMMVPIAHAVLDQLHSSQASSNVEEGSNNPTFELQEPSPQKEVTKLDNGQALPVTSASSEGRAHLSQKHLHLTQC |
| Protein accession: | NP_003975 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.36 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SLC13A2 polyclonal antibody (A01), Lot # 061130JCS1 Western Blot analysis of SLC13A2 expression in MCF-7 ( Cat # L046V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Synthesis, Maturation, and Trafficking of Human Na+-Dicarboxylate Cotransporter NaDC1 Requires the Chaperone Activity of Cyclophilin B.Bergeron MJ, Burzle M, Kovacs G, Simonin A, Hediger MA. J Biol Chem. 2011 Apr 1;286(13):11242-53. Epub 2011 Jan 21. |