| Brand: | Abnova |
| Reference: | H00009056-M04 |
| Product name: | SLC7A7 monoclonal antibody (M04), clone 3B10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC7A7. |
| Clone: | 3B10 |
| Isotype: | IgG2b Kappa |
| Gene id: | 9056 |
| Gene name: | SLC7A7 |
| Gene alias: | LAT3|LPI|MOP-2|Y+LAT1|y+LAT-1 |
| Gene description: | solute carrier family 7 (cationic amino acid transporter, y+ system), member 7 |
| Genbank accession: | NM_003982 |
| Immunogen: | SLC7A7 (NP_003973.2, 462 a.a. ~ 511 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RVPEHKRPLYLRRIVGSATRYLQVLCMSVAAEMDLEDGGEMPKQRDPKSN |
| Protein accession: | NP_003973.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SLC7A7 is approximately 0.1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |